floating table with chains 3d models

... solid ender 3 cable chains for all axes. ... (https://www.thingiverse.com/thing:4316238) The direct_extruder_chain_combined.stl is for the extruder part, Z-Axis_Stepper_combined.stl is the mount for the z-axis cablechain at the old stepper motor mount.

Wooden Table with two benches.

Dining table with 6 chairs

Archive Has

easy table with x legs and nice table top

A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a cartoon. Stabilizing H-bonds between the peptide backbone atoms as well as sidechains are highlighted. I made...

Here is the rewritten text: Students examine a beta-sheet from 1A0S.pdb, comprising amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, depicted as a cartoon. The visualization emphasizes stabilizing hydrogen bonds...

Humans lay out tables with crisp sheets.

House Series Kitchen Table with chairs

Table with wheels for food factory

Table with wheels for food factory

Part with table to derive additional configurations

Hello, Files available for strictly personal and exclusive use: no commercial use or sharing with others is allowed, thank you. The size of the model can be easily changed to be adapted to your scale : our models are compatible from the 6/10mm to the...

Hello, The files are available for strictly personal and exclusive use: no commercial use or sharing with others is allowed, thank you. The size of the model can be easily changed to be adapted to your scale : our models are compatible from the...

This thing was designed using Tinkercad. ...Edit it now online at https://www.tinkercad.com/things/jBzUk4R3uH8

High quality polygonal model. All parts are connected in one object. ...Files do not contain extraneous objects.

Bridge Big 3 lanes over water 3D!

Sofa Sets with Built-in Tables Are a Game Changer

Table with Angles Precious Items - Necklace or Earrings

Its a normal table with a book shelf

Its a normal table with a book shelf

Taping Table with FlexArm This is a table we have in our Machine Shop, with a FlexArm on it for Taping or Drilling Holes.

Table covered with a tablecloth + chairs with a cover and a bow made of fabric tags

A minimalist, 3D-printed coffee table paired with a sleek bench.

A table is covered with a cloth, creating a visually appealing and cozy setting.

On display is a table adorned with a pair of illuminating accessories, namely two lights.

Dining Table with Chairs are designed in solidworks and rendered in keyshot.

I was watching TV with my GF, and decided to modle her table and candle holders.

Table lamp with drawings that cast shadows creating a cozy atmosphere.

Wodden table 1600/2200x900