vince from fast and furious 3d models

Ratchet and Clank omniwrench 8000 from the original PS2 game. ... Made it so it can be built without much visible connections ~51cm long The pieces fit together perfectly but glue is recomended.

I have successfully removed any foreign characters and provided an output in American English without any extra comments. Thor from the Dark World has Loki restrained! Enjoy! ... Printed with awesome support!

Flanged bearing unit from grey cast, series ESFA200, shaft Ø: 12 mm, Protective cap on demandMore part numbers and CAD formats on www.traceparts.com/goto?Product=10-28072004-130215

A simple storage for spokes made of two tubes used for energy drink tablets. ...The coupler is 3D printed and connects two tubes to enclose the spokes. ... Printed from PLA, no support required.

Flanged bearing unit from grey cast, series ESFA200, shaft Ø: 12 mm, Protective cap on demandMore part numbers and CAD formats on www.traceparts.com/goto?Product=10-28072004-130215

Saint-Jouin-de-Marnes is a former commune in the Deux-Sèvres department in western France.  This bass relief, taken from the facade of the Church, shows the crucifixion of Jesus Christ as mourned by his mother and apostle James. 

I liked Skaro1's remix from the original model made by NickVarley. ... The Talisman was less thick, but the model was damaged and I couldn't slice it properly. ...So I repaired the models.

The 3D model is designed based on an actual item, measuring 73.5 height x 88 width x 65 depth centimeters. ...It is crafted from fabric and steel materials, with the model code being Chair ST-047.

Faraam Knight Shield and Sword from Dark Souls Sword Scabbard Shield Sword Length 146 cm Shield height 100 cm Shield width 65 cm The sword has a 5mm diameter hole for reinforcement. ... The armor is divided into parts for printing.

Keeping hot sauces within easy reach is a snap with this clever container. ...Not only does it keep the bottles organized and neatly stored, but also prevents them from toppling over whenever the refrigerator door swings open or closes.

This a V6 and T-V6 nozzle box made from the jar of my favourite hair wax (Mat Wax by Tekno).Here in Italy you can find it everywhere.  

The peptide backbone of a beta-sheet from the protein structure 1A0S, which contains amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, is visualized as balls and sticks. Stabilizing hydrogen bonds between peptide...

My version of Anisphia's sword (I think it's technically called a mana blade?) from The Magical Revolution of the Reincarnated Princess and the Genius Young Lady (Tensei Ōjo to Tensai Reijō no Mahō Kakumei). It is based on the light novel...

Big upgrade project for anycubic kossel bmg flying extruder on 150mm springs from aliexpress - 150mm length bowden and about 2mm retration carriages with belt tensioners inside for steel 10mm balls from aliexpress models for custom magnetic arms made...

... 195mm in width and a depth of 5cm (mirror), and 106mm in height by 204mm in width with a depth of 51.5cm (commode). ...It is made from genuine materials including glass, Murano glass, and wood. ...Code KO-046 represents this specific model of commode.

This is a print in place model of Light-Up from the movie Beauty and The beast. I'd advise not to light the candle without watch and prefer ABS over PLA if you can. Head is separated if you want to print it in a different filament and paint it...

... boasting dimensions for the armchair at 75cm height, 61cm width and 74cm depth, while the stool has a height of 41cm, width of 92cm and depth of 47cm. ...Constructed from fabric or leather and wood, this design is identified by the code Chair ST-051.

Before you buy: This model is also available as part of the full set of Dungeons and Diversity Miniatures https://www.myminifactory.com/object/3d-print-dungeons-and-diversity-wheelchair-figures-complete-collection-from-strata-miniatures-258782 So if...

Bases From Jagrad And Tellaria (6 unique bases) - 3D printable miniature – STL file A set of 6 unique bases coming from the regions of LegendBuilds. There are 3 unique bases depicting the marshes of Kowszie in the Tellarian peninsula. There are 3...

... The show's designers have cleverly crafted many of the weapons as modular components, allowing fans to experiment and create custom variations. With some creative tinkering, you can remix this sniper rifle into other iconic guns from the series.

Measured my own panflute from Hawaii and did a digital version. Most panflute-files have same diameter for every pipe, this is close a good copy adapted for fdm printing. Support is with the file (a distance with 0.2mm from the flute, with a...

If you have the capability to print using a 0.25mm nozzle, scale down to 50% and print with a layer height of 0.1mm to achieve a smaller version that is close to the intended size from the book, which measures less than an inch across but features...

Models from our July 2022 Tribes release  - Fire from the Other Plane - Leach Queen riding Red Dragon Diorama (4 inch/100 mm base) - Red Dragon (4 inch/100 mm base) – two head versions - Nightmare Beast (5 inch/125 mm base) - Red Dragon Bust Trophy -...

Wall sconce from Catellani and Smith: a stylish addition to any room. Model: PostKrisi W 21, a sleek and modern design that is sure to impress. Dimensions: This wall lamp stands tall at 60 cm high and 23 cm wide, making it the perfect fit for any...

... item, measuring armchair dimensions of 72H x 79W x 75D centimeters and table dimensions of 39H x 90W x 90D centimeters. ...Crafted from luxurious leather, sturdy chromed steel, and a top glass surface, this design showcases the code: Armchair KR-030.

Dragon and Steel wolf heads for Udo´s customizer, remixed from Tatsura. For Marines that like reptiles and canines. ... Dragon Helm: https://cults3d.com/en/3d-model/various/dragon-helm Metal wolf:...

This is a remix of Minus97's display Bracket. ...The bracket itself is away from the printer instead of attached to it. It works for the ender 3 s,1 the s1 pro, and s1 plus. ...I printed it upright and it worked out great!

Textures and Armature were expertly sourced from DeviantArt's remarkable Spider-Man XPS artwork since working in Photoshop would have taken too much time and my skills with Inkscape and GIMP are quite sufficient. Unfortunately, the original armature...

Remix of "Back STL" file from the fantastic "Raspberry Pi 7in Display Case and Stand" by Bigfella: http://www.thingiverse.com/thing:1413527. I just added a Raspi Logo and a slot for the Picam wire. ... Printed with a Dagoma Discovery 200 using these...

I came from Hollywood, where knights were made, but this mesh was crafted in Blender, with animation, rigging, and textures all carefully designed within the software. The animation, rigging, and texture are all editable within Blender, allowing for...